PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400049483
Common NameLOC102586087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 26889.4 Da    PI: 9.9236
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400049483genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.23.3e-312574150
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey+
  PGSC0003DMP400049483 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYA 74
                          79***********************************************8 PP

2K-box99.35.4e-3392185396
                 K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                           +s++ s++ea+a+++qqe++kL+++i nLq+++R++lGe+L+s++ keL++Leq++ek+++kiRskKnell+++ie++qk+  e+++++
  PGSC0003DMP400049483  92 SSNTGSVSEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLGSMNSKELKSLEQKIEKGISKIRSKKNELLFAEIEYMQKRIAETERAQ 180
                           3445559***************************************************************************9999988 PP

                 K-box  92 kaLrk 96 
                           ++ ++
  PGSC0003DMP400049483 181 HQHQQ 185
                           87655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.5011777IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-401776IPR002100Transcription factor, MADS-box
CDDcd002652.78E-451894No hitNo description
SuperFamilySSF554554.71E-331890IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-331939IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PfamPF003199.4E-272673IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-333954IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-335475IPR002100Transcription factor, MADS-box
PfamPF014865.4E-23101181IPR002487Transcription factor, K-box
PROSITE profilePS5129713.896103192IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MDFQSDLTRE ISPQRKLGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LVVFSSRGRL YEYANNSVKA TIERYKKACS DSSNTGSVSE ANAQYYQQEA SKLRAQIGNL  120
QNQNRNMLGE SLGSMNSKEL KSLEQKIEKG ISKIRSKKNE LLFAEIEYMQ KRIAETERAQ  180
HQHQQMNLMP GSSSSYHELV PPPQQFDTRN YLQVNGLQTN NHYPRQDQPP IQLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-211785169Myocyte-specific enhancer factor 2B
1tqe_Q8e-211785169Myocyte-specific enhancer factor 2B
1tqe_R8e-211785169Myocyte-specific enhancer factor 2B
1tqe_S8e-211785169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankTOMTAG1A0.0L26295.1 Lycopersicon esculentum TAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358069.11e-174PREDICTED: floral homeotic protein AGAMOUS isoform X3
SwissprotQ401681e-165AG_SOLLC; Floral homeotic protein AGAMOUS
TrEMBLM1CRK81e-174M1CRK8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000731341e-170(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-111MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]